MYL6 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYL6

Key Reference: Fu,Z.Y., (2006) Acta Biochim. Biophys. Sin. (Shanghai) 38 (9), 625-632

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myosin light polypeptide 6

Protein Size: 151

Purification: Affinity Purified

• Artikelnummer: AVIARP57711_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57711_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 4637
• Wirt: Rabbit