English
MYO1C Antibody - N-terminal region : HRP
MYO1C Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56292_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus. The nuclear isoform associates wi
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYO1C
Key Reference: Kahle,M., (2007) Histochem. Cell Biol. 127 (2), 139-148
Molecular Weight: 118kDa
Peptide Sequence: Synthetic peptide located within the following region: NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Unconventional myosin-Ic
Protein Size: 1028
Purification: Affinity Purified
Specificity#: isoform 1, 2 and 3
Description of Target: This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus. The nuclear isoform associates wi
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYO1C
Key Reference: Kahle,M., (2007) Histochem. Cell Biol. 127 (2), 139-148
Molecular Weight: 118kDa
Peptide Sequence: Synthetic peptide located within the following region: NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Unconventional myosin-Ic
Protein Size: 1028
Purification: Affinity Purified
Specificity#: isoform 1, 2 and 3
| Artikelnummer | AVIARP56292_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56292_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 4641 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
