NCF4 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NCF4

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: PSLRPLPLTSPSHGSLSHSKAPSGSQMSHNAVTSHQRPGWPGQPHSPFPH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neutrophil cytosol factor 4

Protein Size: 348

Purification: Affinity Purified

• Artikelnummer: AVIARP58922_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58922_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4689
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin