NDUFC1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NDUFC1 is the accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The imme

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFC1

Key Reference: Loeffen,J.L., (1998) Biochem. Biophys. Res. Commun. 253 (2), 415-422

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial

Protein Size: 76

Purification: Affinity Purified

Subunit: C1, mitochondrial

• Artikelnummer: AVIARP56360_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56360_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4717
• Wirt: Rabbit