Ndufs1 Antibody - N-terminal region : FITC

Ndufs1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56608_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ndufs1 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ndufs1

Molecular Weight: 79kDa

Peptide Sequence: Synthetic peptide located within the following region: VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

Protein Size: 727

Purification: Affinity Purified

Subunit: , mitochondrial
Mehr Informationen
Artikelnummer AVIARP56608_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56608_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 301458
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×