Necap1 Antibody - N-terminal region : Biotin

Necap1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55273_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Necap1 may be involved in endocytosis.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: RYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISKE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Adaptin ear-binding coat-associated protein 1

Protein Size: 275

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55273_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55273_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 67602
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×