NES Antibody - middle region : Biotin

NES Antibody - middle region : Biotin
Artikelnummer
AVIARP58779_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Nestin is an intermediate filament protein that was first identified with a monoclonal antibody by Hockfield and McKay (1985) [PubMed 4078630]. It is expressed predominantly in stem cells of the central nervous system in the neural tube. Upon terminal neu

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NES

Key Reference: Scobioala,S., (2008) FASEB J. 22 (4), 1021-1031

Molecular Weight: 177kDa

Peptide Sequence: Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nestin

Protein Size: 1621

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58779_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58779_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 10763
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×