NES Antibody - middle region : HRP

NES Antibody - middle region : HRP
Artikelnummer
AVIARP58779_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Nestin is an intermediate filament protein that was first identified with a monoclonal antibody by Hockfield and McKay (1985) [PubMed 4078630]. It is expressed predominantly in stem cells of the central nervous system in the neural tube. Upon terminal neu

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NES

Key Reference: Scobioala,S., (2008) FASEB J. 22 (4), 1021-1031

Molecular Weight: 177kDa

Peptide Sequence: Synthetic peptide located within the following region: LPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKEGWDPAVLASEGLEA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nestin

Protein Size: 1621

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58779_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58779_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 10763
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×