NFATC1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: NFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Different isoforms of this protein may regulate inducible expression of different cytokine genes.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC1

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: PRHSPSTSPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nuclear factor of activated T-cells c1 isoform IB-IXL EMBL ACG55580.1

Protein Size: 930

Purification: Affinity Purified

• Artikelnummer: AVIARP59144_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59144_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4772
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin