English
Nfkbiz Antibody - C-terminal region : Biotin
Nfkbiz Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57676_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: Nfkbiz is involved in regulation of NF-kappa-B transcription factor complexes. It inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation. It inhibits DNA-binding of RELA and NFKB1/p50, and of the NF-kappa-B p65-p50 heterodimer and the NF-kappa-B p50-p50 homodimer. It seems also to activate NF-kappa-B-mediated transcription. In vitro, upon association with NFKB1/p50, Nfkbiz has transcriptional activation activity and, together with NFKB1/p50 and RELA, Nfkbiz is recruited to LCN2 promoters.
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Molecular Weight: 80kDa
Peptide Sequence: Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: NF-kappa-B inhibitor zeta
Protein Size: 728
Purification: Affinity Purified
Description of Target: Nfkbiz is involved in regulation of NF-kappa-B transcription factor complexes. It inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation. It inhibits DNA-binding of RELA and NFKB1/p50, and of the NF-kappa-B p65-p50 heterodimer and the NF-kappa-B p50-p50 homodimer. It seems also to activate NF-kappa-B-mediated transcription. In vitro, upon association with NFKB1/p50, Nfkbiz has transcriptional activation activity and, together with NFKB1/p50 and RELA, Nfkbiz is recruited to LCN2 promoters.
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Molecular Weight: 80kDa
Peptide Sequence: Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: NF-kappa-B inhibitor zeta
Protein Size: 728
Purification: Affinity Purified
| Artikelnummer | AVIARP57676_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57676_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 80859 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
