NIT1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells; this effect is additive to the tum

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NIT1

Key Reference: Semba,S., (2006) J. Biol. Chem. 281 (38), 28244-28253

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nitrilase homolog 1

Protein Size: 327

Purification: Affinity Purified

• Artikelnummer: AVIARP56647_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56647_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4817
• Wirt: Rabbit