English
NLRP5 Antibody - N-terminal region : FITC
NLRP5 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP59021_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: The protein encoded by this gene belongs to the NALP protein family. Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). Expression of this gene is restricted to the oocyte. A mouse gene that encodes a maternal oocyte protein, similar to this encoded protein, is required for normal early embryogenesis.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP5
Molecular Weight: 134kDa
Peptide Sequence: Synthetic peptide located within the following region: LAWATSISIFENMNLRTLSEKARDDMKRHSPEDPEATMTDQGPSKEKVPG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: NACHT, LRR and PYD domains-containing protein 5
Protein Size: 1200
Purification: Affinity Purified
Description of Target: The protein encoded by this gene belongs to the NALP protein family. Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). Expression of this gene is restricted to the oocyte. A mouse gene that encodes a maternal oocyte protein, similar to this encoded protein, is required for normal early embryogenesis.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP5
Molecular Weight: 134kDa
Peptide Sequence: Synthetic peptide located within the following region: LAWATSISIFENMNLRTLSEKARDDMKRHSPEDPEATMTDQGPSKEKVPG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: NACHT, LRR and PYD domains-containing protein 5
Protein Size: 1200
Purification: Affinity Purified
| Artikelnummer | AVIARP59021_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP59021_P050-FITC |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 126206 |
| Wirt | Rabbit |
| Konjugat | Conjugated, FITC |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
