NMRAL1 Antibody - middle region : FITC

NMRAL1 Antibody - middle region : FITC
Artikelnummer
AVIARP58502_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein is binding , oxidoreductase activity ,and transcription repressor activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NMRAL1

Key Reference: Zhao,Y., (2008) J. Biol. Chem. 283 (16), 11004-11013

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NmrA-like family domain-containing protein 1

Protein Size: 299

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58502_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58502_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57407
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×