NMRAL1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein is binding , oxidoreductase activity ,and transcription repressor activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NMRAL1

Key Reference: Zhao,Y., (2008) J. Biol. Chem. 283 (16), 11004-11013

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NmrA-like family domain-containing protein 1

Protein Size: 299

Purification: Affinity Purified

• Artikelnummer: AVIARP58502_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58502_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57407
• Wirt: Rabbit
• Konjugat: Conjugated, HRP