NOB1 Antibody - C-terminal region : Biotin

NOB1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54976_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: NOB1 may play a role in mRNA degradation.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NOB1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: LPTPKGGKYAINPHLTEDQRFPQLRLSQKARQKTNVFAPDYIAGVSPFVE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: RNA-binding protein NOB1

Protein Size: 412

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54976_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54976_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 28987
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×