NOB1 Antibody - N-terminal region : FITC

NOB1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54975_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NOB1 may play a role in mRNA degradation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NOB1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: RNA-binding protein NOB1

Protein Size: 412

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54975_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54975_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 28987
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×