NOLA3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOLA3

Molecular Weight: 8kDa

Peptide Sequence: Synthetic peptide located within the following region: MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: H/ACA ribonucleoprotein complex subunit 3

Protein Size: 64

Purification: Affinity Purified

Subunit: 3

• Artikelnummer: AVIARP57279_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57279_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55505
• Wirt: Rabbit