English
NOMO1 Antibody - N-terminal region : HRP
NOMO1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54997_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NOMO1
Key Reference: Lim,J., (2006) Cell 125 (4), 801-814
Molecular Weight: 134kDa
Peptide Sequence: Synthetic peptide located within the following region: DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Nodal modulator 3
Protein Size: 1222
Purification: Affinity Purified
Description of Target: NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NOMO1
Key Reference: Lim,J., (2006) Cell 125 (4), 801-814
Molecular Weight: 134kDa
Peptide Sequence: Synthetic peptide located within the following region: DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Nodal modulator 3
Protein Size: 1222
Purification: Affinity Purified
| Artikelnummer | AVIARP54997_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54997_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 23420 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
