Nppc Antibody - C-terminal region : Biotin

Nppc Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57660_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the natriuretic peptide family. Natriuretic peptides are involved in the control of blood pressure, extracellular fluid volume and electrolyte homeostasis. The encoded protein also plays a role in sensory neuron bifurcation, and is a critical regulator of endochondral bone growth. The encoded protein is a ligand for the natriuretic peptide receptor B, and is synthesized as a preprohormone which is cleaved to produce a mature peptide. Mutations in this gene are associated with dwarfism resulting from impaired endochondral ossification.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Nppc

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: C-type natriuretic peptide

Protein Size: 126

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57660_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57660_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18159
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×