NPTX2 Antibody - N-terminal region : HRP

NPTX2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56365_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the family of neuronal petraxins, synaptic proteins that are related to C-reactive protein. This protein is involved in excitatory synapse formation. It also plays a role in clustering of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)-type glutamate receptors at established synapses, resulting in non-apoptotic cell death of dopaminergic nerve cells. Up-regulation of this gene in Parkinson disease (PD) tissues suggests that the protein may be involved in the pathology of PD.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NPTX2

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Neuronal pentraxin-2

Protein Size: 431

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56365_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56365_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4885
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×