NRBP1 Antibody - N-terminal region : Biotin

NRBP1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54949_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: NRBP1 may play a role in subcellular trafficking between the endoplasmic reticulum and Golgi apparatus through interactions with the Rho-type GTPases. Binding to the NS3 protein of dengue virus type 2 appears to subvert this activity into the alteration of the intracellular membrane structure associated with flaviviral replication.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRBP1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: DESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nuclear receptor-binding protein

Protein Size: 535

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54949_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54949_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29959
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×