English
NRBP2 Antibody - middle region : Biotin
NRBP2 Antibody - middle region : Biotin
Artikelnummer
AVIARP58823_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The specific function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRBP2
Key Reference: Wan,D., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729
Molecular Weight: 30kDa
Peptide Sequence: Synthetic peptide located within the following region: VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Nuclear receptor-binding protein 2
Protein Size: 258
Purification: Affinity Purified
Description of Target: The specific function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRBP2
Key Reference: Wan,D., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729
Molecular Weight: 30kDa
Peptide Sequence: Synthetic peptide located within the following region: VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Nuclear receptor-binding protein 2
Protein Size: 258
Purification: Affinity Purified
| Artikelnummer | AVIARP58823_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58823_P050-Biotin |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 340371 |
| Wirt | Rabbit |
| Konjugat | Conjugated, Biotin |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
