NRBP2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRBP2

Key Reference: Wan,D., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nuclear receptor-binding protein 2

Protein Size: 258

Purification: Affinity Purified

• Artikelnummer: AVIARP58823_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58823_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 340371
• Wirt: Rabbit
• Konjugat: Conjugated, FITC