NRG4 Recombinant

NRG4 Recombinant
Artikelnummer
BPS90254-A
Verpackungseinheit
20 µg
Hersteller
BPS Bioscience

Verfügbarkeit: wird geladen...
Preis wird geladen...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 5-65

Amino Acid Sequence: HEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAF

Background: Neuregulins (NDF, heregulin, GGF ARIA, or SMDF) are EGF- like growth and differentiation factors that signal through tyrosine kinase receptors of the ErbB family. The ErbB2 and ErbB4 receptors cooperate in transmission of neuregulin-1 signals in the heart, whereas ErbB2 and ErbB3 cooperate in neural crest cells.

Biological Activity: The ED50 was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be <3ng/ml, corresponding to a specific activity of 3x 10^5 Units/mg.

Description: Recombinant human Neuregulin-4 EGF domain is a disulfide-linked monomeric protein consisting of 62 amino acid residue subunits, and migrates as an approximately 7 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-4 EGF domain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered 20 mM phosphate buffer, pH 6.0.

Genbank: Q8WWG1

Purity: ≥96% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: Q8WWG1

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)
Mehr Informationen
Artikelnummer BPS90254-A
Hersteller BPS Bioscience
Hersteller Artikelnummer 90254-A
Verpackungseinheit 20 µg
Mengeneinheit STK
Produktinformation (PDF)
×
MSDS (PDF)
×