NRP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: NRP1 is a membrane-bound coreceptor to a tyrosine kinase receptor for both vascular endothelial growth factor (VEGF; MIM 192240) and semaphorin (see SEMA3A; MIM 603961) family members. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRP1

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: FNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neuropilin-1

Protein Size: 644

Purification: Affinity Purified

• Artikelnummer: AVIARP59101_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP59101_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 8829
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin