NSMCE3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is part of the SMC5-6 chromatin reorganizing complex and is a member of the MAGE superfamily. This is an intronless gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDNL2

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: non-structural maintenance of chromosomes element 3 homolog

Protein Size: 304

Purification: Affinity Purified

• Artikelnummer: AVIARP57727_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57727_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 56160
• Wirt: Rabbit