NT5C1B Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes (Sala-Newby and Newby, 2001 [PubMed 11690631]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NT5C1B

Key Reference: Wang,A. Biochim. Biophys. Acta 1521 (1-3), 12-18 (2001)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic 5'-nucleotidase 1B

Protein Size: 550

Purification: Affinity Purified

• Artikelnummer: AVIARP58646_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58646_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 93034
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin