English
NT5C1B Antibody - N-terminal region : HRP
NT5C1B Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58646_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes (Sala-Newby and Newby, 2001 [PubMed 11690631]).[supplied by OMIM].
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NT5C1B
Key Reference: Wang,A. Biochim. Biophys. Acta 1521 (1-3), 12-18 (2001)
Molecular Weight: 61kDa
Peptide Sequence: Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Cytosolic 5'-nucleotidase 1B
Protein Size: 550
Purification: Affinity Purified
Description of Target: Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes (Sala-Newby and Newby, 2001 [PubMed 11690631]).[supplied by OMIM].
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NT5C1B
Key Reference: Wang,A. Biochim. Biophys. Acta 1521 (1-3), 12-18 (2001)
Molecular Weight: 61kDa
Peptide Sequence: Synthetic peptide located within the following region: MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Cytosolic 5'-nucleotidase 1B
Protein Size: 550
Purification: Affinity Purified
| Artikelnummer | AVIARP58646_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58646_P050-HRP |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 93034 |
| Wirt | Rabbit |
| Konjugat | Conjugated, HRP |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
