Ntf3 Antibody - N-terminal region : FITC

Ntf3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56367_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ntf3 is a neuronal survival protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Ntf3

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neurotrophin-3

Protein Size: 258

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56367_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56367_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 81737
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×