NUDCD3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The product of this gene functions to maintain the stability of dynein intermediate chain. Depletion of this gene product results in aggregation and degradation of dynein intermediate chain, mislocalization of the dynein complex from kinetochores, spindle

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUDCD3

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: KINKERSMATVDEEEQAVLDRLTFDYHQKLQGKPQSHELKVHEMLKKGWD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NudC domain-containing protein 3

Protein Size: 361

Purification: Affinity Purified

• Artikelnummer: AVIARP55233_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55233_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23386
• Wirt: Rabbit