NXT1 Antibody - N-terminal region : HRP

NXT1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54919_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NXT1

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: GTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NTF2-related export protein 1

Protein Size: 140

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54919_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54919_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29107
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×