Ofd1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Molecular Weight: 112kDa

Peptide Sequence: Synthetic peptide located within the following region: AQSTMPHKCDDVLSQDELRKKLYQTFKDRGILDTLKTQLRNQLVHELMHP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein Ofd1 Ensembl ENSRNOP00000006074

Protein Size: 1025

Purification: Affinity Purified

• Artikelnummer: AVIARP58559_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58559_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 302661
• Wirt: Rabbit
• Konjugat: Conjugated, HRP