OGDH Antibody - N-terminal region : FITC

OGDH Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58648_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO2. It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).This gene encodes one subunit of the 2-oxoglutarate dehydrogenase complex. This complex catalyzes the overall conversion of 2-oxoglutarate (alpha-ketoglutarate) to succinyl-CoA and CO(2) during the Krebs cycle. The protein is located in the mitocondrial matrix and uses thiamine pyrophosphate as a cofactor. A congential deficiency in 2-oxoglutarate dehydrogenase activity is believed to lead to hypotonia, metabolic acidosis, and hyperlactatemia.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OGDH

Key Reference: van (2007) Am. J. Med. Genet. A 143 (7), 763-767

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 2-oxoglutarate dehydrogenase, mitochondrial

Protein Size: 427

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58648_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58648_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4967
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×