English
OLFML1 Antibody - middle region : Biotin
OLFML1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55874_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The specific function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OLFML1
Key Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824
Molecular Weight: 46kDa
Peptide Sequence: Synthetic peptide located within the following region: LCGVLYVVYSTGGQGPHRITCIYDPLGTISEEDLPNLFFPKRPRSHSMIH
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Olfactomedin-like protein 1
Protein Size: 402
Purification: Affinity Purified
Description of Target: The specific function of this protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OLFML1
Key Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824
Molecular Weight: 46kDa
Peptide Sequence: Synthetic peptide located within the following region: LCGVLYVVYSTGGQGPHRITCIYDPLGTISEEDLPNLFFPKRPRSHSMIH
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Olfactomedin-like protein 1
Protein Size: 402
Purification: Affinity Purified
| Artikelnummer | AVIARP55874_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55874_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 283298 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
