OMD Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OMD

Key Reference: Couble,M.L., (2004) Histochem. Cell Biol. 121 (1), 47-53

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Osteomodulin

Protein Size: 421

Purification: Affinity Purified

Subunit: 5

• Artikelnummer: AVIARP56612_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56612_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 56612
• Wirt: Rabbit