OR10X1 Antibody - middle region : Biotin

OR10X1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58506_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: OR10X1 is an odorant receptor.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OR10X1

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Olfactory receptor 10X1

Protein Size: 326

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58506_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58506_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 128367
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×