Pa2g4 Antibody - C-terminal region : Biotin

Pa2g4 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57879_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Pa2g4 may play a role in a ERBB3-regulated signal transduction pathway. It seems be involved in growth regulation. It acts a corepressor of the androgen receptor (AR) and is regulated by the ERBB3 ligand neuregulin-1/heregulin (HRG). It inhibits transcription of some E2F1-regulated promoters, probably by recruiting histone acetylase (HAT) activity. It may be involved in ribosome assembly. It mediates cap-independent translation of specific viral IRESs (internal ribosomal entry site). It together with PTBP1 is required for the translation initiation on the foot-and-mouth disease virus (FMDV) IRES.

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: PDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTVENATSGETLEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proliferation-associated protein 2G4

Protein Size: 394

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57879_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57879_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18813
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×