PAIP2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: PAIP2 acts as a repressor in the regulation of translation initiation of poly(A)-containing mRNAs. Its inhibitory activity on translation is mediated via its action on PABPC1. It displaces the interaction of PABPC1 with poly(A) RNA and competes with PAIP1 for binding to PABPC1. Its association with PABPC1 results in disruption of the cytoplasmic poly(A) RNP structure organization.

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Polyadenylate-binding protein-interacting protein 2

Protein Size: 127

Purification: Affinity Purified

• Artikelnummer: AVIARP56241_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56241_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51247
• Wirt: Rabbit