PathPlus™ CD36 Antibody

Specificity: Human CD36

Antibody Modification: Unconjugated

Presentation: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 301-400 of human CD36 (NP_001120916.1). ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQ

Gene: CD36

Description: CD36 antibody LS-B15329 is an unconjugated rabbit polyclonal antibody to CD36 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.

Usage: The predicted MW is 32kDa/46kDa/48kDa/53kDa, while the observed MW by Western blot was 85kDa/100kDa.

Synonyms: CD36, Cluster determinant 36, FAT, Fatty acid translocase, Glycoprotein IIIb, gp4, GPIIIB, GPIV, PAS-4 protein, PAS IV, PASIV, Platelet collagen receptor, Platelet glycoprotein IV, SCARB3, Thrombospondin receptor, BDPLT10, CD36 antigen, CHDS7, gp3B, PAS-4, Platelet glycoprotein 4

Recommended Storage: Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.

• Artikelnummer: LIFLS-B15329-50
• Hersteller: LSBio
• Hersteller Artikelnummer: LS-B15329-50
• Verpackungseinheit: 50 µl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus)
• Klonalität: Polyclonal
• Methode: Immunohistochemistry (paraffin), Western Blotting, Immunohistochemistry
• Isotyp: IgG
• Human Gene ID: 948
• Wirt: Rabbit
• Konjugat: Unconjugated