English
PAX1 Antibody - middle region : HRP
PAX1 Antibody - middle region : HRP
Artikelnummer
AVIARP58040_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates.The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates (McGaughran et al., 2003 [PubMed 12774041]). See PAX7 (MIM 167410) for a discussion of paired box domain genes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAX1
Key Reference: Vatanavicharn,N., (2007) Am. J. Med. Genet. A 143 (19), 2292-2302
Molecular Weight: 46kDa
Peptide Sequence: Synthetic peptide located within the following region: SISRILRNKIGSLAQPGPYEASKQPPSQPTLPYNHIYQYPYPSPVSPTGA
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Paired box protein Pax-1
Protein Size: 440
Purification: Affinity Purified
Description of Target: The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates.The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates (McGaughran et al., 2003 [PubMed 12774041]). See PAX7 (MIM 167410) for a discussion of paired box domain genes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAX1
Key Reference: Vatanavicharn,N., (2007) Am. J. Med. Genet. A 143 (19), 2292-2302
Molecular Weight: 46kDa
Peptide Sequence: Synthetic peptide located within the following region: SISRILRNKIGSLAQPGPYEASKQPPSQPTLPYNHIYQYPYPSPVSPTGA
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Paired box protein Pax-1
Protein Size: 440
Purification: Affinity Purified
| Artikelnummer | AVIARP58040_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58040_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 5075 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
