PCCB Antibody - middle region : Biotin

PCCB Antibody - middle region : Biotin
Artikelnummer
AVIARP56116_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCCB

Key Reference: Desviat,L.R., (2006) J. Hum. Genet. 51 (11), 992-997

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Propionyl-CoA carboxylase beta chain, mitochondrial

Protein Size: 539

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56116_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56116_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5096
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×