PCCB Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCCB

Key Reference: Desviat,L.R., (2006) J. Hum. Genet. 51 (11), 992-997

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Propionyl-CoA carboxylase beta chain, mitochondrial

Protein Size: 539

Purification: Affinity Purified

• Artikelnummer: AVIARP56116_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56116_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5096
• Wirt: Rabbit