PDAP1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PDAP1 enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDAP1

Key Reference: Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 28 kDa heat- and acid-stable phosphoprotein

Protein Size: 181

Purification: Affinity Purified

• Artikelnummer: AVIARP58790_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58790_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11333
• Wirt: Rabbit
• Konjugat: Conjugated, HRP