PDCD7 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramid

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDCD7

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Programmed cell death protein 7

Protein Size: 485

Purification: Affinity Purified

• Artikelnummer: AVIARP58777_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58777_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 10081
• Wirt: Rabbit
• Konjugat: Conjugated, FITC