PDCD7 Antibody - middle region : HRP

PDCD7 Antibody - middle region : HRP
Artikelnummer
AVIARP58777_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramid

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDCD7

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Programmed cell death protein 7

Protein Size: 485

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58777_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58777_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10081
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×