English
PDE4D Antibody - C-terminal region : Biotin
PDE4D Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56673_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins.
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDE4D
Molecular Weight: 55kDa
Peptide Sequence: Synthetic peptide located within the following region: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Protein Size: 507
Purification: Affinity Purified
Description of Target: This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins.
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDE4D
Molecular Weight: 55kDa
Peptide Sequence: Synthetic peptide located within the following region: FQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQ
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Protein Size: 507
Purification: Affinity Purified
| Artikelnummer | AVIARP56673_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56673_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 5144 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
