PDE6A Antibody - N-terminal region : HRP

PDE6A Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56111_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes the cyclic-GMP (cGMP)-specific phosphodiesterase 6A alpha subunit, expressed in cells of the retinal rod outer segment. The phosphodiesterase 6 holoenzyme is a heterotrimer composed of an alpha, beta, and two gamma subunits. cGMP is an important regulator of rod cell membrane current, and its dynamic concentration is established by phosphodiesterase 6A cGMP hydrolysis and guanylate cyclase cGMP synthesis. The protein is a subunit of a key phototransduction enzyme and participates in processes of transmission and amplification of the visual signal. Mutations in this gene have been identified as one cause of autosomal recessive retinitis pigmentosa.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human PDE6A

Molecular Weight: 85kDa

Peptide Sequence: Synthetic peptide located within the following region: YRTRNGIAELATRLFNVHKDAVLEDCLVMPDQEIVFPLDMGIVGHVAHSK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha

Protein Size: 779

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56111_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56111_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5145
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×