PDE8A Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Phosphodiesterases (PDEs) regulate the intracellular levels of cAMP and cGMP. These cyclic nucleotides play an important role as second messengers in multiple physiologic processes, including regulation of vascular resistance, cardiac output, visceral motility, immune response, inflammation, neuroplasticity, vision, and reproduction. PDEs comprise a large superfamily of enzymes divided into 10 families. Different PDEs can be distinguished by their structure, tissue expression, localization, substrate specificity, regulation, and sensitivity to PDE inhibitors. Diversity in structure and specificity of function make PDEs promising targets for the pharmacotherapy of diseases modulated by cyclic nucleotide signaling (Hetman et al., MIM 2000).

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PDE8A

Molecular Weight: 91kDa

Peptide Sequence: Synthetic peptide located within the following region: SSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A

Protein Size: 829

Purification: Affinity Purified

• Artikelnummer: AVIARP57752_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57752_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5151
• Wirt: Rabbit