PDLIM3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PDLIM3 contains a PDZ domain and a LIM domain, indicating that it may be involved in cytoskeletal assembly. In support of this, PDLIM3 has been shown to bind the spectrin-like repeats of alpha-actinin-2 and to colocalize with alpha-actinin-2 at the Z lines of skeletal muscle.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDLIM3

Key Reference: Arola,A.M., (2007) Mol. Genet. Metab. 90 (4), 435-440

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PDZ and LIM domain protein 3

Protein Size: 364

Purification: Affinity Purified

• Artikelnummer: AVIARP55067_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55067_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27295
• Wirt: Rabbit