PDXDC1 Antibody - N-terminal region : HRP

PDXDC1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55147_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PDXDC1 belongs to the group II decarboxylase family. The function of PDXDC1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDXDC1

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: DEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Pyridoxal-dependent decarboxylase domain-containing protein 1

Protein Size: 788

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55147_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55147_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23042
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×